PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009590635.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 389aa    MW: 43422.1 Da    PI: 8.1539
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009590635.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.66.2e-50321581128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                     + pGfrF+Ptdeel+++yLkkk+eg++  + evi+ev+i k+ePwdLp k+v ++++ew+fFs+r +ky++g++++rat+sgyWkatgk+++v+s
  XP_009590635.1  32 MFPGFRFSPTDEELISYYLKKKLEGSDKCV-EVISEVEIWKHEPWDLPaKSVIQSDNEWFFFSPRGRKYPNGSQSKRATESGYWKATGKERNVKS 125
                     579************************777.99***************667777899************************************** PP

             NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++ +g+k+tLvf++grapkg++t+W+mhey +
  XP_009590635.1 126 -GSNIMGTKRTLVFHTGRAPKGQRTHWIMHEYCM 158
                     .999****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.23E-5628175IPR003441NAC domain
PROSITE profilePS5100554.21932176IPR003441NAC domain
PfamPF023652.4E-2634157IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009626Biological Processplant-type hypersensitive response
GO:0009910Biological Processnegative regulation of flower development
GO:0034976Biological Processresponse to endoplasmic reticulum stress
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MEDGHVSGSR NENSRTARNN NVEISIATAS SMFPGFRFSP TDEELISYYL KKKLEGSDKC  60
VEVISEVEIW KHEPWDLPAK SVIQSDNEWF FFSPRGRKYP NGSQSKRATE SGYWKATGKE  120
RNVKSGSNIM GTKRTLVFHT GRAPKGQRTH WIMHEYCMSG STNYQDSMVV CRLRKNSEFH  180
LNDTPRNQLA AIACATTQSG AGQLGSLELV TIGDCCCSKE GSSSFYSHSV EQIDSGSESD  240
KPTKEFSQHD SSGHFKDCDG EEDWFADIMK DDIIKLDDSS LNAQPISMVP SRPESSISTH  300
EAQAAMSGVA PFQGTANRRL RLVKVVVCPV EGSRMYEATK KNKIGVSTTS SGRWLRNMIS  360
VKRMKQYVMP IFLVVFILLV MLLNMLGVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-452317611168NAC domain-containing protein 19
3swm_B3e-452317611168NAC domain-containing protein 19
3swm_C3e-452317611168NAC domain-containing protein 19
3swm_D3e-452317611168NAC domain-containing protein 19
3swp_A3e-452317611168NAC domain-containing protein 19
3swp_B3e-452317611168NAC domain-containing protein 19
3swp_C3e-452317611168NAC domain-containing protein 19
3swp_D3e-452317611168NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754451e-112HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009590635.10.0PREDICTED: NAC domain-containing protein 89-like
RefseqXP_016441918.10.0PREDICTED: NAC domain-containing protein 89-like
TrEMBLM1A5E50.0M1A5E5_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000150770.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41542243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22290.14e-81NAC domain containing protein 89